Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MORC3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

MORC family CW-type zinc finger 3

Gene Aliases

MORC family CW-type zinc finger protein 3; nuclear matrix protein 2; nuclear matrix protein NXP2; NXP2; ZCW5; ZCWCC3; zinc finger CW-type coiled-coil domain protein 3; zinc finger, CW type with coiled-coil domain 3.

Gene ID

23515

Accession Number

NP_056173

Reactivity

Homo sapiens|Human

Target

Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696) . Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696) . Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504) . Binds RNA in vitro (PubMed:11927593) . May be required for influenza A transcription during viral infection (PubMed:26202233) .

Type

Protein

Source

E.coli

Sequence

MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MORC3

Protein Name

MORC family CW-type zinc finger protein 3

Gene Name URL

MORC3

Nucleotide Accession Number

NM_015358

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein E Recombinant Antibody, RBITC Conjugated
bsm-61226R-RBITC-01 20 µL

Apolipoprotein E Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Apolipoprotein E Recombinant Antibody, RBITC Conjugated
bsm-61226R-RBITC-02 100 µL

Apolipoprotein E Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal YPEL4 Antibody [Alexa Fluor 647]
NBP2-81957AF647 0.1 mL

Rabbit Polyclonal YPEL4 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Fish Epigen ELISA Kit
MBS055212 Inquire

Fish Epigen ELISA Kit

Sign In for Pricing
View Details
SMYD3 Antibody
CSB-PA224595-01 50 μL

SMYD3 Antibody

Sign In for Pricing
View Details
SMYD3 Antibody
CSB-PA224595-02 100 µL

SMYD3 Antibody

Sign In for Pricing
View Details