Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORF3 Recombinant Protein (Potato leafroll virus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Coat protein.

Reactivity

Potato Leafroll Virus

Target

Major capsid protein.

Type

Protein

Source

E.coli

Sequence

MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ORF3

Protein Name

Major capsid protein

Gene Name URL

ORF3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Omentin ELISA Kit
NSL0729Ca 96 Tests

Canine Omentin ELISA Kit

Sign In for Pricing
View Details
Anti-Neurofilament L (Rabbit, Polyclonal)
A117137 100 µL

Anti-Neurofilament L (Rabbit, Polyclonal)

Sign In for Pricing
View Details
Chorionic Gonadotropin, Human, beta (hCGb)
C5069-06P 1 mg

Chorionic Gonadotropin, Human, beta (hCGb)

Sign In for Pricing
View Details
MEF2D (Myocyte-specific Enhancer Factor 2D, DKFZp686I1536) (MaxLight 550)
129561-ML550 100 µL

MEF2D (Myocyte-specific Enhancer Factor 2D, DKFZp686I1536) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri tRNA modification GTPase MnmE (mnmE)
MBS1409641-01 0.02 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri tRNA modification GTPase MnmE (mnmE)
MBS1409641-02 0.02 mg (Yeast)

Recombinant Xanthomonas axonopodis pv. citri tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details