Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytochrome P450 family 11 subfamily B member 2

Gene Aliases

ALDOS; aldosterone synthase; aldosterone-synthesizing enzyme; corticosterone 18-monooxygenase, CYP11B2; CPN2; CYP11B; CYP11BL; CYPXIB2; cytochrome P450 11B2, mitochondrial; cytochrome P450, family 11, subfamily B, polypeptide 2; cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2; cytochrome P-450Aldo; cytochrome P-450C18; mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2; P450aldo; P450C18; P-450C18; steroid 11-beta/18-hydroxylase; steroid 11-beta-hydroxylase, CYP11B2; steroid 11-beta-monooxygenase; Steroid 18-hydroxylase; steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo.

Gene ID

1585

Accession Number

NP_000489

Reactivity

Homo sapiens|Human

Target

Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.

Type

Protein

Source

E.coli

Sequence

GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

71 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CYP11B2

Protein Name

Cytochrome P450 11B2, mitochondrial

Gene Name URL

CYP11B2

Nucleotide Accession Number

NM_000498

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP3
pro-652 5µg

VAMP3

Sign In for Pricing
View Details
Cellulose Extraction Thimbles, Without Binder, 80 OD x 200 H, 2.5~3.0 mm thickness, 25pcs/pk
22031029 25 Pieces

Cellulose Extraction Thimbles, Without Binder, 80 OD x 200 H, 2.5~3.0 mm thickness, 25pcs/pk

Sign In for Pricing
View Details
Rabbit Monoclonal BCMA/TNFRSF17 Antibody (CD269/8508R) [Janelia Fluor 525]
NBP3-20821JF525 0.1 mL

Rabbit Monoclonal BCMA/TNFRSF17 Antibody (CD269/8508R) [Janelia Fluor 525]

Sign In for Pricing
View Details
Rabbit Polyclonal CYP4B1 Antibody
NBP2-16068 0.1 mL

Rabbit Polyclonal CYP4B1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) INVS Polyclonal Antibody
MBS7139949 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) INVS Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 15 (MMP15)
SIPA736Hu01-01 10 µg

Recombinant Matrix Metalloproteinase 15 (MMP15)

Sign In for Pricing
View Details