Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM150A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

ALK and LTK ligand 1

Gene Aliases

ALK and LTK ligand 1; AUGA; AUGB; AUG-beta; augmentor beta; augmentor-alpha; FAM150A; family with sequence similarity 150 member A; protein FAM150A; RPLK9433; UNQ9433.

Gene ID

389658

Accession Number

NP_997296

Reactivity

Homo sapiens|Human

Target

Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK; activation of ALK is reported conflictingly.

Type

Protein

Source

E.coli

Sequence

RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ALKAL1

Protein Name

ALK and LTK ligand 1

Gene Name URL

ALKAL1

Nucleotide Accession Number

NM_207413

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD14B (E-3) : m-IgG Fc BP-HRP Bundle
sc-552035 1 Kit

BTBD14B (E-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
ETV6 Rabbit Polyclonal Antibody
orb626836-01 50 µg

ETV6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ETV6 Rabbit Polyclonal Antibody
orb626836-02 100 µg

ETV6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ST6GALNAC5 shRNA (UAS) - Lentiviral human ST6GALNAC5 shRNA (UAS) (100)
GTR15077862 1 Vial

Lentiviral human ST6GALNAC5 shRNA (UAS) - Lentiviral human ST6GALNAC5 shRNA (UAS) (100)

Sign In for Pricing
View Details
Human TTD non-photosensitive 1 protein, TTDN1 ELISA KIT
ELI-40065h 96 Tests

Human TTD non-photosensitive 1 protein, TTDN1 ELISA KIT

Sign In for Pricing
View Details
Caveolin 1 (CAV1, caveolae protein, 22kD , HGNC:1527, CAV, MSTP085, VIP21, caveolin 1, alpha isoform, caveolin 1, beta isoform, cell growth-inhibiting protein 32) (MaxLight 550)
C2097-91-ML550 100 µL

Caveolin 1 (CAV1, caveolae protein, 22kD , HGNC:1527, CAV, MSTP085, VIP21, caveolin 1, alpha isoform, caveolin 1, beta isoform, cell growth-inhibiting protein 32) (MaxLight 550)

Sign In for Pricing
View Details