Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Putative invertase inhibitor Recombinant Protein (London plane tree)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pollen allergen Pla a 1.

Reactivity

Platanus acerifolia

Target

Invertase inhibitor.

Type

Protein

Source

Yeast

Sequence

ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.6 kDa

Protein Length

Recombinant

Protein Name

Putative invertase inhibitor

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sav1 (NM_022028) Mouse Untagged Clone
MC202958 10 µg

Sav1 (NM_022028) Mouse Untagged Clone

Sign In for Pricing
View Details
Sheep CASP7 (Caspase 7) ELISA Kit
MBS2506584-01 24 Tests

Sheep CASP7 (Caspase 7) ELISA Kit

Sign In for Pricing
View Details
Sheep CASP7 (Caspase 7) ELISA Kit
MBS2506584-02 48 Tests

Sheep CASP7 (Caspase 7) ELISA Kit

Sign In for Pricing
View Details
Sheep CASP7 (Caspase 7) ELISA Kit
MBS2506584-03 96 Tests

Sheep CASP7 (Caspase 7) ELISA Kit

Sign In for Pricing
View Details
Sheep CASP7 (Caspase 7) ELISA Kit
MBS2506584-04 5x 96 Tests

Sheep CASP7 (Caspase 7) ELISA Kit

Sign In for Pricing
View Details
Sheep CASP7 (Caspase 7) ELISA Kit
MBS2506584-05 10x 96 Tests

Sheep CASP7 (Caspase 7) ELISA Kit

Sign In for Pricing
View Details