Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F11 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Coagulation factor XI

Gene Aliases

Coagualtion factor XI; coagulation factor XI; FXI; plasma thromboplastin antecedent; PTA.

Gene ID

2160

Accession Number

NP_000119

Reactivity

Homo sapiens|Human

Target

Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Type

Protein

Source

E.coli

Sequence

ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

F11

Protein Name

Coagulation factor XI

Gene Name URL

F11

Nucleotide Accession Number

NM_000128

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Bcl2 Modifying Factor ELISA Kit
MBS044294-01 48 Well

Human Bcl2 Modifying Factor ELISA Kit

Sign In for Pricing
View Details
Human Bcl2 Modifying Factor ELISA Kit
MBS044294-02 96 Well

Human Bcl2 Modifying Factor ELISA Kit

Sign In for Pricing
View Details
Human Bcl2 Modifying Factor ELISA Kit
MBS044294-03 5x 96 Well

Human Bcl2 Modifying Factor ELISA Kit

Sign In for Pricing
View Details
Human Bcl2 Modifying Factor ELISA Kit
MBS044294-04 10x 96 Well

Human Bcl2 Modifying Factor ELISA Kit

Sign In for Pricing
View Details
Sunlong Medical™ Human sTNF RII/TNFRSF1B ELISA Kit
EL0244Hu-01 48 Tests

Sunlong Medical™ Human sTNF RII/TNFRSF1B ELISA Kit

Sign In for Pricing
View Details
Sunlong Medical™ Human sTNF RII/TNFRSF1B ELISA Kit
EL0244Hu-02 96 Tests

Sunlong Medical™ Human sTNF RII/TNFRSF1B ELISA Kit

Sign In for Pricing
View Details