What is the catalog number for EPCAM Recombinant Protein (Human)?

The catalog number for EPCAM Recombinant Protein (Human) is OPCA04220-20UG.

What sizes are available for EPCAM Recombinant Protein (Human)?

EPCAM Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is EPCAM Recombinant Protein (Human) in stock?

EPCAM Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

EPCAM Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Epithelial cell adhesion molecule

Gene Aliases

Adenocarcinoma-associated antigen; cell surface glycoprotein Trop-1; DIAR5; EGP-2; EGP314; EGP40; epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; epithelial glycoprotein 314; ESA; HNPCC8; human epithelial glycoprotein-2; KS 1/4 antigen; KS1/4; KSA; M4S1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein) ; MIC18; MK-1; TACSTD1; TROP1; trophoblast cell surface antigen 1; tumor-associated calcium signal transducer 1.

Gene ID

4072

Accession Number

NP_002345

Reactivity

Homo sapiens|Human

Target

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Type

Protein

Source

E.coli

Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.