Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Non-specific lipid-transfer protein 1 Recombinant Protein (Peach)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Pru p 1; Major allergen Pru p 3.

Reactivity

Prunus persica

Target

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Type

Protein

Source

E.coli

Sequence

ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.2 kDa

Protein Length

Recombinant

Protein Name

Non-specific lipid-transfer protein 1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Risedronate
S1874-50mg 50 mg

Risedronate

Sign In for Pricing
View Details
FAM212B Adenovirus (Human)
19948051 1.0 mL

FAM212B Adenovirus (Human)

Sign In for Pricing
View Details
LCOR Antibody
E40PV8592 50 µL

LCOR Antibody

Sign In for Pricing
View Details
TREX2 Blocking peptide
orb1442332 500 µg

TREX2 Blocking peptide

Sign In for Pricing
View Details
Mouse Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit
DLR-SLC30A3-Mu-01 48 Tests

Mouse Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit

Sign In for Pricing
View Details
Mouse Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit
DLR-SLC30A3-Mu-02 96 Tests

Mouse Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit

Sign In for Pricing
View Details