Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thymic stromal lymphopoietin

Gene Aliases

Thymic stromal lymphopoietin.

Gene ID

85480

Accession Number

NP_149024

Reactivity

Homo sapiens|Human

Target

Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c (+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Type

Protein

Source

E.coli

Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TSLP

Protein Name

Thymic stromal lymphopoietin

Gene Name URL

TSLP

Nucleotide Accession Number

NM_033035

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Varicella Zoster Virus (VZV) gE antibody, mouse monoclonal (#9), WB, IP, IF/ICC, Azide and carrier free
65-358 Inquire

Anti-Varicella Zoster Virus (VZV) gE antibody, mouse monoclonal (#9), WB, IP, IF/ICC, Azide and carrier free

Sign In for Pricing
View Details
PPP3CA Antibody / Calcineurin
V8010SAF-100UG 100 µg

PPP3CA Antibody / Calcineurin

Sign In for Pricing
View Details
Sev Antibody
orb803983 2 mg

Sev Antibody

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund UPF0259 membrane protein yciC (yciC)
MBS7034018-01 0.02 mg

Recombinant Salmonella schwarzengrund UPF0259 membrane protein yciC (yciC)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund UPF0259 membrane protein yciC (yciC)
MBS7034018-02 0.1 mg

Recombinant Salmonella schwarzengrund UPF0259 membrane protein yciC (yciC)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund UPF0259 membrane protein yciC (yciC)
MBS7034018-03 5x 0.1 mg

Recombinant Salmonella schwarzengrund UPF0259 membrane protein yciC (yciC)

Sign In for Pricing
View Details