Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CR2 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Complement C3d receptor.

Reactivity

Mouse|Mus musculus

Target

Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.

Type

Protein

Source

E.coli

Sequence

ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CR2

Protein Name

Complement receptor type 2

Gene Name URL

CR2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF852 Antibody
NBP2-13601 0.1 mL

Rabbit Polyclonal ZNF852 Antibody

Sign In for Pricing
View Details
ZNF346 Rabbit pAb, PerCP-Cy7 conjugated
orb2840548 100 µL

ZNF346 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
BBC3 Antibody (Center) Blocking peptide
MBS9220458-01 0.5 mg

BBC3 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
BBC3 Antibody (Center) Blocking peptide
MBS9220458-02 5x 0.5 mg

BBC3 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
Cldn10 (NM_001106058) Rat Tagged ORF Clone Lentiviral Particle
RR210808L3V 200 µL

Cldn10 (NM_001106058) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
N-Nitroso Vortioxetine Impurity 1
CS-O-52322 1 Each

N-Nitroso Vortioxetine Impurity 1

Sign In for Pricing
View Details