Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CR2 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Complement C3d receptor.

Reactivity

Mouse|Mus musculus

Target

Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.

Type

Protein

Source

E.coli

Sequence

ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCES

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CR2

Protein Name

Complement receptor type 2

Gene Name URL

CR2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LYPLA3 Protein - (Dry Ice)
H00023659-Q01-10ug 10 µg

Recombinant Human LYPLA3 Protein - (Dry Ice)

Sign In for Pricing
View Details
EXOSC1 3'UTR Luciferase Stable Cell Line
TU007129 1.0 mL

EXOSC1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human MIR3200 qPCR Primer Pair
QH83977S 200 Tests

Human MIR3200 qPCR Primer Pair

Sign In for Pricing
View Details
FXYD7 Antibody
6465-01mg 0.1 mg

FXYD7 Antibody

Sign In for Pricing
View Details
Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit
MBS4501449-01 48 Tests

Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit

Sign In for Pricing
View Details
Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit
MBS4501449-02 96 Tests

Human Neuronal Pentraxin Receptor (NPTXR) ELISA Kit

Sign In for Pricing
View Details