Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Tumor necrosis factor

Gene Aliases

Cachectin; DI; DIF; Tn; TNF-; Tnfa; TNF-a; TNFalpha; TNF-alpha; Tnfs; Tnfsf1a; TNFSF2; Tnlg1f; tumor necrosis factor; tumor necrosis factor ligand 1f; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor-alpha.

Gene ID

21926

Accession Number

NP_001265530

Reactivity

Mouse|Mus musculus

Target

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

Type

Protein

Source

E.coli

Sequence

GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tnf

Protein Name

Tumor necrosis factor

Gene Name URL

Tnf

Nucleotide Accession Number

NM_001278601

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR1 peptide
orb12947 1 mg

FPR1 peptide

Sign In for Pricing
View Details
Mouse Class E basic helix loop helix protein 23 (BHLHE23) ELISA kit
GTR10372015 96 Well

Mouse Class E basic helix loop helix protein 23 (BHLHE23) ELISA kit

Sign In for Pricing
View Details
NR1D1 (Nuclear Receptor Subfamily 1 Group D Member 1, Rev-erbA-alpha, V-erbA-related Protein 1, EAR-1, EAR1, HREV, THRAL) (HRP)
MBS6153852-01 0.1 mL

NR1D1 (Nuclear Receptor Subfamily 1 Group D Member 1, Rev-erbA-alpha, V-erbA-related Protein 1, EAR-1, EAR1, HREV, THRAL) (HRP)

Sign In for Pricing
View Details
NR1D1 (Nuclear Receptor Subfamily 1 Group D Member 1, Rev-erbA-alpha, V-erbA-related Protein 1, EAR-1, EAR1, HREV, THRAL) (HRP)
MBS6153852-02 5x 0.1 mL

NR1D1 (Nuclear Receptor Subfamily 1 Group D Member 1, Rev-erbA-alpha, V-erbA-related Protein 1, EAR-1, EAR1, HREV, THRAL) (HRP)

Sign In for Pricing
View Details
4930547C10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3264107 1.0 µg DNA

4930547C10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
RO6889678 10mg
A22490-10 10 mg

RO6889678 10mg

Sign In for Pricing
View Details