Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

K3L Recombinant Protein (Vaccinia virus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

K3L, Protein K3

Reactivity

Vaccinia Virus

Target

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff (By similarity) .

Type

Protein

Source

E.coli

Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

26.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

K3L

Protein Name

Protein K3

Gene Name URL

K3L

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV2-CMV-Srf-HA-Puro Plasmid
PVT48406 2 µg

pLV2-CMV-Srf-HA-Puro Plasmid

Sign In for Pricing
View Details
KChIP2 (KCNIP2) (NM_173197) Human Tagged Lenti ORF Clone
RC211485L3 10 µg

KChIP2 (KCNIP2) (NM_173197) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dlk1 (NM_053744) Rat Tagged Lenti ORF Clone
RR209622L3 10 µg

Dlk1 (NM_053744) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ctr9 AAV siRNA Pooled Vector
17083166 1.0 µg

Ctr9 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Oral cancer-overexpressed protein 1, ORAOV1 ELISA Kit
MBS9322775-01 48 Well

Mouse Oral cancer-overexpressed protein 1, ORAOV1 ELISA Kit

Sign In for Pricing
View Details
Mouse Oral cancer-overexpressed protein 1, ORAOV1 ELISA Kit
MBS9322775-02 96 Well

Mouse Oral cancer-overexpressed protein 1, ORAOV1 ELISA Kit

Sign In for Pricing
View Details