Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFV Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

H2A.Z variant histone 2

Gene Aliases

H2A histone family member V; H2A.F/Z; H2A.Z-2; H2AFV; H2AV; histone H2A.F/Z; histone H2A.V; purine-rich binding element protein B.

Gene ID

94239

Accession Number

NP_036544

Reactivity

Homo sapiens|Human

Target

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2AZ2

Protein Name

Histone H2A.V

Gene Name URL

H2AZ2

Nucleotide Accession Number

NM_012412

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL39L Antibody
A19460-100UG 100 µg

RPL39L Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Lamin B2 Antibody (OTI2C6) [Dylight 594]
NBP2-72303DL594 0.1 mL

Mouse Monoclonal Lamin B2 Antibody (OTI2C6) [Dylight 594]

Sign In for Pricing
View Details
PRSS42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37858111 3x 1.0 µg

PRSS42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal CGI-16 Antibody [Alexa Fluor 532]
NBP3-18476AF532 0.1 mL

Rabbit Polyclonal CGI-16 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Nfkb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
31776114 3x 1.0 µg

Nfkb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Methionine aminopeptidase 2
orb1644187-01 50 µg

Methionine aminopeptidase 2

Sign In for Pricing
View Details