Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAMP2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Vesicle associated membrane protein 2

Gene Aliases

NEDHAHM; SYB2; synaptobrevin 2; Synaptobrevin-2; VAMP-2; vesicle-associated membrane protein 2.

Gene ID

6844

Accession Number

NP_055047

Reactivity

Homo sapiens|Human

Target

Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

Type

Protein

Source

E.coli

Sequence

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VAMP2

Protein Name

Vesicle-associated membrane protein 2

Gene Name URL

VAMP2

Nucleotide Accession Number

NM_014232

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neto1 (NM_144946) Mouse Tagged ORF Clone Lentiviral Particle
MR208549L3V 200 µL

Neto1 (NM_144946) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PKC delta/theta Recombinant Antibody, Cy5 Conjugated
bsm-62953R-Cy5-TR 20 µL

PKC delta/theta Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Human ZKSCAN1 Knockout A549 cell line
GTR15409206 1 Vial

Human ZKSCAN1 Knockout A549 cell line

Sign In for Pricing
View Details
ARHGEF7 CRISPRa sgRNA lentivector (set of three targets)(Human)
12345121 3x 1.0µg DNA

ARHGEF7 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human Carboxypeptidase N catalytic chain,CPN1 ELISA KIT
JOT-EK2435Hu-01 96 Well

Human Carboxypeptidase N catalytic chain,CPN1 ELISA KIT

Sign In for Pricing
View Details
Human Carboxypeptidase N catalytic chain,CPN1 ELISA KIT
JOT-EK2435Hu-02 48 Well

Human Carboxypeptidase N catalytic chain,CPN1 ELISA KIT

Sign In for Pricing
View Details