Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAMP2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Vesicle associated membrane protein 2

Gene Aliases

NEDHAHM; SYB2; synaptobrevin 2; Synaptobrevin-2; VAMP-2; vesicle-associated membrane protein 2.

Gene ID

6844

Accession Number

NP_055047

Reactivity

Homo sapiens|Human

Target

Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

Type

Protein

Source

E.coli

Sequence

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VAMP2

Protein Name

Vesicle-associated membrane protein 2

Gene Name URL

VAMP2

Nucleotide Accession Number

NM_014232

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT4 (E125) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (MaxLight 750) discontinued
039256-ML750 100 µL

OCT4 (E125) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GPATCH3 Polyclonal Antibody, RBITC Conjugated
bs-13500R-RBITC 100 µL

GPATCH3 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
C6orf146 3'UTR Lenti-reporter-Luc Vector
14621081 1.0 µg

C6orf146 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FBXO16 Antibody - N-terminal region : FITC (ARP53226_P050-FITC)
ARP53226_P050-FITC 100 µL

FBXO16 Antibody - N-terminal region : FITC (ARP53226_P050-FITC)

Sign In for Pricing
View Details
Human TRAF6 Knockout A549 cell line
GTR15407505 1 Vial

Human TRAF6 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Ta1 (Thymosin-alpha1) ELISA Kit
MBS2514499-01 24 Tests

Mouse Ta1 (Thymosin-alpha1) ELISA Kit

Sign In for Pricing
View Details