What is the catalog number for TM4SF1 Recombinant Protein (Human)?

The catalog number for TM4SF1 Recombinant Protein (Human) is OPCA04184-20UG.

What sizes are available for TM4SF1 Recombinant Protein (Human)?

TM4SF1 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is TM4SF1 Recombinant Protein (Human) in stock?

TM4SF1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

TM4SF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Transmembrane 4 L six family member 1

Gene Aliases

H-L6; L6; M3S1; Membrane component chromosome 3 surface marker 1; membrane component, chromosome 3, surface marker 1; TAAL6; transmembrane 4 L6 family member 1; transmembrane 4 superfamily member 1; tumor-associated antigen L6.

Gene ID

4071

Reactivity

Homo sapiens|Human

Type

Protein

Source

Yeast

Sequence

LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.