Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Apolipoprotein B

Gene Aliases

ApoB-100; apoB-48; apolipoprotein B (including Ag (x) antigen) ; apolipoprotein B-100; apolipoprotein B48; FCHL2; FLDB; LDLCQ4.

Gene ID

338

Accession Number

NP_000375

Reactivity

Homo sapiens|Human

Target

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100) . Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Type

Protein

Source

Yeast

Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

APOB

Protein Name

Apolipoprotein B-100

Gene Name URL

APOB

Nucleotide Accession Number

NM_000384

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psp Peptide
42-308P 0.1 mg

Psp Peptide

Sign In for Pricing
View Details
ZMYND10 Protein Lysate
OCOA10499-20UG 20 µg

ZMYND10 Protein Lysate

Sign In for Pricing
View Details
KIF1A Protein Lysate (Mouse) with C-HA Tag
25666034 100 µg

KIF1A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal Nucleocapsid Antibody (1051436) [Biotin]
FAB11289B 0.1 mL

Mouse Monoclonal Nucleocapsid Antibody (1051436) [Biotin]

Sign In for Pricing
View Details
SMARCA2, Bromodomain, Recombinant, Human, aa1375-1511, His-Tag (BRM, BRG1-Associated Factor 190B, SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin 2, BAF190, SNF2L2)
298459 100 µg

SMARCA2, Bromodomain, Recombinant, Human, aa1375-1511, His-Tag (BRM, BRG1-Associated Factor 190B, SWI/SNF Related, Matrix Associated, Actin Dependent Regulator Of Chromatin 2, BAF190, SNF2L2)

Sign In for Pricing
View Details
PLV3-U6-ALDH2-shRNA3-Puro Plasmid
PVT81799 2 µg

PLV3-U6-ALDH2-shRNA3-Puro Plasmid

Sign In for Pricing
View Details