Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LECT1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Chondromodulin

Gene Aliases

BRICD3; BRICHOS domain containing 3; CHM1; CHM-I; Chondromodulin; chondromodulin-1; chondromodulin-I; LECT1; leukocyte cell derived chemotaxin 1; leukocyte cell-derived chemotaxin 1; multiple myeloma tumor suppressor 1; MYETS1.

Gene ID

11061

Accession Number

NP_001011705

Reactivity

Homo sapiens|Human

Target

Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.

Type

Protein

Source

E.coli

Sequence

EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CNMD

Protein Name

Leukocyte cell-derived chemotaxin 1

Gene Name URL

CNMD

Nucleotide Accession Number

NM_001011705

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Digital Microplate Shaker 230V
MIX1308 1 Each

Digital Microplate Shaker 230V

Sign In for Pricing
View Details
Rat Peli1 Pre-designed siRNA Set B
SI210298B 1 Each

Rat Peli1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyclo (RADfK)
orb1296652-01 1 mg

Cyclo (RADfK)

Sign In for Pricing
View Details
Cyclo (RADfK)
orb1296652-02 5 mg

Cyclo (RADfK)

Sign In for Pricing
View Details
Cyclo (RADfK)
orb1296652-03 10 mg

Cyclo (RADfK)

Sign In for Pricing
View Details
Cyclo (RADfK)
orb1296652-04 25 mg

Cyclo (RADfK)

Sign In for Pricing
View Details