Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMA5 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Laminin subunit alpha 5

Gene Aliases

Laminin alpha-5 chain; laminin subunit alpha-5; laminin-10 subunit alpha; laminin-11 subunit alpha; laminin-15 subunit alpha.

Gene ID

3911

Accession Number

NP_005551

Reactivity

Homo sapiens|Human

Target

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Type

Protein

Source

E.coli

Sequence

FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LAMA5

Protein Name

Laminin subunit alpha-5

Gene Name URL

LAMA5

Nucleotide Accession Number

NM_005560

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 9 Activity Colorimetric Assay Kit
E-CK-A313-01 20 Assays

Caspase 9 Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Caspase 9 Activity Colorimetric Assay Kit
E-CK-A313-02 50 Assays

Caspase 9 Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Caspase 9 Activity Colorimetric Assay Kit
E-CK-A313-03 100 Assays

Caspase 9 Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Sheep Hemoglobin (Hb) ELISA Kit
AE64603SH-01 48 Tests

Sheep Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details
Sheep Hemoglobin (Hb) ELISA Kit
AE64603SH-02 96 Tests

Sheep Hemoglobin (Hb) ELISA Kit

Sign In for Pricing
View Details
Purified Anti-Mouse CD3ε Antibody
DL21227F-01 50 μg

Purified Anti-Mouse CD3ε Antibody

Sign In for Pricing
View Details