Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mite group 2 allergen Lep d 2 Recombinant Protein (Glycyphagus destructor)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Lep d 1; Allergen Lep d I.

Reactivity

Lepidoglyphus destructor

Type

Protein

Source

E.coli

Sequence

GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.1 kDa

Protein Length

Recombinant

Protein Name

Mite group 2 allergen Lep d 2

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEMIN8P CRISPR Knock Out 293T Cell Line (Human)
57979141 1x 10^6 Cells / 1.0 mL

GEMIN8P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human ovarian cancer antigenX1 (OVX1) ELISA Kit
QY-E02223 96 Tests

Human ovarian cancer antigenX1 (OVX1) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
MBS2138350-01 0.1 mL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
MBS2138350-02 0.2 mL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
MBS2138350-03 0.5 mL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
MBS2138350-04 1 mL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details