Mite group 2 allergen Lep d 2 Recombinant Protein (Glycyphagus destructor)
Product Specifications
CAS Number
9000-83-3
Gene Aliases
Allergen Lep d 1; Allergen Lep d I.
Reactivity
Lepidoglyphus destructor
Type
Protein
Source
E.coli
Sequence
GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
29.1 kDa
Protein Length
Recombinant
Protein Name
Mite group 2 allergen Lep d 2
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941993-500 1x 500 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471505-500 1x 500 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041207-500 1x 500 µL
CD74 (LN-2 + CLIP/813), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681919-100 1x 100 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details