Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G12A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Phospholipase A2 group XIIA

Gene Aliases

Group XII secreted phospholipase A2; group XIIA secreted phospholipase A2; group XIIA secretory phospholipase A2; GXII; GXII sPLA2; phosphatidylcholine 2-acylhydrolase 12A; phospholipase A2, group XII; PLA2G12; ROSSY; sPLA2-XII.

Gene ID

81579

Accession Number

NP_110448

Reactivity

Homo sapiens|Human

Target

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Type

Protein

Source

Yeast

Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PLA2G12A

Protein Name

Group XIIA secretory phospholipase A2

Gene Name URL

PLA2G12A

Nucleotide Accession Number

NM_030821

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Beta mannosidase (β-Manase) ELISA Kit
AE62767HU-01 48 Tests

Human Beta mannosidase (β-Manase) ELISA Kit

Sign In for Pricing
View Details
Human Beta mannosidase (β-Manase) ELISA Kit
AE62767HU-02 96 Tests

Human Beta mannosidase (β-Manase) ELISA Kit

Sign In for Pricing
View Details
Caveolin 2 (CAV2) (NM_198212) Human Tagged Lenti ORF Clone
RC217364L4 10 µg

Caveolin 2 (CAV2) (NM_198212) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr1701 (NM_001001114) Rat Tagged ORF Clone Lentiviral Particle
RR211611L4V 200 µL

Olr1701 (NM_001001114) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human SPARCL1 Pre-designed siRNA Set A
SI015575A 1 Each

Human SPARCL1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Protein Interacting with Protein Kinase C, Alpha 1 (PICK1) ELISA Kit
orb1949165-01 48 Tests

Human Protein Interacting with Protein Kinase C, Alpha 1 (PICK1) ELISA Kit

Sign In for Pricing
View Details