What is the catalog number for Arachin Ahy-3 Recombinant Protein (Peanut)?

The catalog number for Arachin Ahy-3 Recombinant Protein (Peanut) is OPCA04160-20UG.

What sizes are available for Arachin Ahy-3 Recombinant Protein (Peanut)?

Arachin Ahy-3 Recombinant Protein (Peanut) is available in the following size(s): 20 µg.

Is Arachin Ahy-3 Recombinant Protein (Peanut) in stock?

Arachin Ahy-3 Recombinant Protein (Peanut) is currently made to order / not held in immediate stock. Contact us for lead time.

Arachin Ahy-3 Recombinant Protein (Peanut)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha, Arachin Ahy-3 chain beta]

Reactivity

Arachis hypogaea|Peanut

Type

Protein

Source

Yeast

Sequence

GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.