Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arachin Ahy-3 Recombinant Protein (Peanut)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha, Arachin Ahy-3 chain beta]

Reactivity

Arachis hypogaea|Peanut

Type

Protein

Source

Yeast

Sequence

GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.9 kDa

Protein Length

Recombinant

Protein Name

Arachin Ahy-3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ATP6AP1 Antibody (3H11B12)
NBP3-27175-0.1mL 0.1 mL

Mouse Monoclonal ATP6AP1 Antibody (3H11B12)

Sign In for Pricing
View Details
Socs7 Mouse siRNA Oligo Duplex (Locus ID 192157)
SR417700 1 Kit

Socs7 Mouse siRNA Oligo Duplex (Locus ID 192157)

Sign In for Pricing
View Details
Angiopoietin-related protein 7
orb1644239-01 50 µg

Angiopoietin-related protein 7

Sign In for Pricing
View Details
Angiopoietin-related protein 7
orb1644239-02 100 µg

Angiopoietin-related protein 7

Sign In for Pricing
View Details
Angiopoietin-related protein 7
orb1644239-03 1 mg

Angiopoietin-related protein 7

Sign In for Pricing
View Details
PARG 3'UTR Luciferase Stable Cell Line
TU017394 1.0 mL

PARG 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details