Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hirudin variant-1 Recombinant Protein (Medicinal leech)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Hirudin-1; Hirudin-I.

Reactivity

Hirudo medicinalis

Target

Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.

Type

Protein

Source

Yeast

Sequence

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9 kDa

Protein Length

Recombinant

Protein Name

Hirudin variant-1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Chicken IgY Fc fragment
MBS396946-01 0.5 mg

Goat anti Chicken IgY Fc fragment

Sign In for Pricing
View Details
Goat anti Chicken IgY Fc fragment
MBS396946-02 5x 0.5 mg

Goat anti Chicken IgY Fc fragment

Sign In for Pricing
View Details
IFNA21 ELISA Kit (Human)
OKCD00206-96W 96 Well

IFNA21 ELISA Kit (Human)

Sign In for Pricing
View Details
Tubulin inhibitor 6
T13224-01 5 mg

Tubulin inhibitor 6

Sign In for Pricing
View Details
Tubulin inhibitor 6
T13224-02 1 mL - 10 mM (in DMSO)

Tubulin inhibitor 6

Sign In for Pricing
View Details
Tubulin inhibitor 6
T13224-03 10 mg

Tubulin inhibitor 6

Sign In for Pricing
View Details