Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptavidin Recombinant Protein (Streptomyces avidinii)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Streptavidin

Reactivity

Streptomyces avidinii

Target

The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin) .

Type

Protein

Source

Yeast

Sequence

DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.5 kDa

Protein Length

Recombinant

Protein Name

Streptavidin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL
BNC942597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL
BNC882284-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF770 conjugate, 0.1mg/mL
BNC700470-500 1x 500 µL

CD45 / LCA (2B11), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF405S conjugate, 0.1mg/mL
BNC041564-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details