Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2A Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Name

Phospholipase A2 group IIA

Gene Aliases

Eted enzyme type IIA phospholipase A2; GIIC sPLA2; group IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; phospholipase A2, group IIA (platelets, synovial fluid) ; phospholipase A2, membrane associated; platelet phospholipase A2; sPLA2.

Gene ID

29692

Accession Number

NP_113786

Reactivity

Rat|Rattus norvegicus

Target

Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (PubMed:3356705) . Thought to participate in the regulation of phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Acts as a ligand for integrins. Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1. Independent of its catalytic activity, activates integrins by binding to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and inducing integrin conformational changes and enhanced ligand binding to site 1. Induces cell proliferation in an integrin-dependent manner (By similarity) .

Type

Protein

Source

Yeast

Sequence

SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Pla2g2a

Protein Name

Phospholipase A2, membrane associated

Gene Name URL

Pla2g2a

Nucleotide Accession Number

NM_031598

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BCL6 Protein, His & Trx Tag
KMPH3475-01 50 µg

Human BCL6 Protein, His & Trx Tag

Sign In for Pricing
View Details
Human BCL6 Protein, His & Trx Tag
KMPH3475-02 100 µg

Human BCL6 Protein, His & Trx Tag

Sign In for Pricing
View Details
LRRN3 Antibody - N-terminal region
ARP47422_P050-25UL 25 µL

LRRN3 Antibody - N-terminal region

Sign In for Pricing
View Details
NATtrol Adenovirus Type 07A Stock (Qualitative)
NATADV7A-ST 1 mL

NATtrol Adenovirus Type 07A Stock (Qualitative)

Sign In for Pricing
View Details
USP16 Rabbit Polyclonal Antibody (HRP)
orb478111 100 µL

USP16 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Treponema pallidum
2123 100 ug

Treponema pallidum

Sign In for Pricing
View Details