What is the catalog number for GRA1 Recombinant Protein (Toxoplasma gondii)?

The catalog number for GRA1 Recombinant Protein (Toxoplasma gondii) is OPCA04142-1MG.

What sizes are available for GRA1 Recombinant Protein (Toxoplasma gondii)?

GRA1 Recombinant Protein (Toxoplasma gondii) is available in the following size(s): 1 mg.

Is GRA1 Recombinant Protein (Toxoplasma gondii) in stock?

GRA1 Recombinant Protein (Toxoplasma gondii) is currently made to order / not held in immediate stock. Contact us for lead time.

GRA1 Recombinant Protein (Toxoplasma gondii)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Major antigen p24.

Reactivity

Toxoplasma gondii

Type

Protein

Source

Yeast

Sequence

AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.