Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFA Recombinant Protein (Rabbit)

Product Specifications

CAS Number

9000-83-3

Accession Number

https://www.ncbi.nlm.nih.gov/protein/XP_002714743.1

Reactivity

Rabbit

Type

Protein

Source

Yeast

Sequence

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VEGFA

Protein Name

PREDICTED: vascular endothelial growth factor A [Oryctolagus cuniculus]

Gene Name URL

VEGFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UPF0574 protein C9orf169, C9orf169 ELISA Kit
MBS9326627-01 48 Well

Human UPF0574 protein C9orf169, C9orf169 ELISA Kit

Sign In for Pricing
View Details
Human UPF0574 protein C9orf169, C9orf169 ELISA Kit
MBS9326627-02 96 Well

Human UPF0574 protein C9orf169, C9orf169 ELISA Kit

Sign In for Pricing
View Details
Human UPF0574 protein C9orf169, C9orf169 ELISA Kit
MBS9326627-03 5x 96 Well

Human UPF0574 protein C9orf169, C9orf169 ELISA Kit

Sign In for Pricing
View Details
Human UPF0574 protein C9orf169, C9orf169 ELISA Kit
MBS9326627-04 10x 96 Well

Human UPF0574 protein C9orf169, C9orf169 ELISA Kit

Sign In for Pricing
View Details
Myosin Heavy Chain 4, Skeletal Muscle (MYH4, MYH2B)
141536 200 µL

Myosin Heavy Chain 4, Skeletal Muscle (MYH4, MYH2B)

Sign In for Pricing
View Details
ZNF449 (NM_152695) Human Tagged ORF Clone Lentiviral Particle
RC209172L4V 200 µL

ZNF449 (NM_152695) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details