Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPRT Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Nicotinate phosphoribosyltransferase

Gene Aliases

FHA-HIT-interacting protein; NAPRT1; NAPRTase; nicotinate phosphoribosyltransferase; nicotinate phosphoribosyltransferase domain containing 1; nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinic acid phosphoribosyltransferase; PP3856.

Gene ID

93100

Accession Number

NP_001273758

Reactivity

Homo sapiens|Human

Target

Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN) . Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.

Type

Protein

Source

Yeast

Sequence

MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NAPRT

Protein Name

Nicotinate phosphoribosyltransferase

Gene Name URL

NAPRT

Nucleotide Accession Number

NM_001286829

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human IFI27L2 sgRNA gene knockout kit - Lentiviral human IFI27L2 sgRNA gene knockout kit (25)
GTR15377439 1 Vial

Lentiviral human IFI27L2 sgRNA gene knockout kit - Lentiviral human IFI27L2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit Anti-P2RX2 Polyclonal Antibody
PAV2891 100 μL

Rabbit Anti-P2RX2 Polyclonal Antibody

Sign In for Pricing
View Details
DPRX CRISPR Knock Out 293T Cell Line (Human)
18558141 1x 10^6 Cells / 1.0 mL

DPRX CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
TFIID Polyclonal Antibody
BT-AP08952-01 20 µL

TFIID Polyclonal Antibody

Sign In for Pricing
View Details
TFIID Polyclonal Antibody
BT-AP08952-02 50 µL

TFIID Polyclonal Antibody

Sign In for Pricing
View Details
TFIID Polyclonal Antibody
BT-AP08952-03 100 µL

TFIID Polyclonal Antibody

Sign In for Pricing
View Details