Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Membrane-spanning 4-domains, subfamily A, member 1

Gene Aliases

AA960661; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; Cd20; CD20 antigen; Ly-4; Ly-44; lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 2; Ms4a2.

Gene ID

12482

Accession Number

NP_031667

Reactivity

Mouse|Mus musculus

Target

This protein may be involved in the regulation of B-cell activation and proliferation.

Type

Protein

Source

Yeast

Sequence

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ms4a1

Protein Name

B-lymphocyte antigen CD20

Gene Name URL

Ms4a1

Nucleotide Accession Number

NM_007641

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fc Fragment of IgG Low Affinity IIIa Receptor (FcgR3A) BioAssayTM ELISA Kit (Human)
024975-01 48 Tests

Fc Fragment of IgG Low Affinity IIIa Receptor (FcgR3A) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Fc Fragment of IgG Low Affinity IIIa Receptor (FcgR3A) BioAssayTM ELISA Kit (Human)
024975-02 96 Tests

Fc Fragment of IgG Low Affinity IIIa Receptor (FcgR3A) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Nutf2 Rat shRNA Plasmid (Locus ID 291981)
TR700819 1 Kit

Nutf2 Rat shRNA Plasmid (Locus ID 291981)

Sign In for Pricing
View Details
HRV 3C Protease
UA080013-01 100 µg

HRV 3C Protease

Sign In for Pricing
View Details
HRV 3C Protease
UA080013-02 1 mg

HRV 3C Protease

Sign In for Pricing
View Details
RAB7L1 Protein Vector (Human) (pPM-C-HA)
38363021 500 ng

RAB7L1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details