Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKI67 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Marker of proliferation Ki-67

Gene Aliases

Antigen identified by monoclonal antibody Ki-67; antigen Ki67; KIA; MIB-; MIB-1; Molecular Immunology Borstel antibody 1; PPP1R105; proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105.

Gene ID

4288

Accession Number

NP_001139438

Reactivity

Homo sapiens|Human

Target

Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226) . Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226) . Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226) . Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551) . Does not contribute to the internal structure of mitotic chromosomes (By similarity) . May play a role in chromatin organization (PubMed:24867636) . It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable) .

Type

Protein

Source

Yeast

Sequence

NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MKI67

Protein Name

Proliferation marker protein Ki-67

Gene Name URL

MKI67

Nucleotide Accession Number

NM_001145966

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A45 Lentiviral Activation Particles (m)
sc-430714-LAC 200 µL

SLC25A45 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
PRAME Protein Vector (Human) (pPB-C-His)
PV032649 500 ng

PRAME Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Chicken MMP13 ELISA Kit
E108998 1 Each

Chicken MMP13 ELISA Kit

Sign In for Pricing
View Details
Human UQCC1 knockout cell line
ABC-KH16577 1 Vial

Human UQCC1 knockout cell line

Sign In for Pricing
View Details
GPRASP2 (G-Protein Coupled Receptor- Associated Sorting Protein 2, GASP-2) discontinued
360349-01 50 µL

GPRASP2 (G-Protein Coupled Receptor- Associated Sorting Protein 2, GASP-2) discontinued

Sign In for Pricing
View Details
GPRASP2 (G-Protein Coupled Receptor- Associated Sorting Protein 2, GASP-2) discontinued
360349-02 100 µL

GPRASP2 (G-Protein Coupled Receptor- Associated Sorting Protein 2, GASP-2) discontinued

Sign In for Pricing
View Details