Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCND1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Potassium voltage-gated channel subfamily D member 1

Gene Aliases

KV4.1; potassium channel, voltage gated Shal related subfamily D, member 1; potassium voltage-gated channel subfamily D member 1; potassium voltage-gated channel, Shal-related subfamily, member 1; Shal-type potassium channel; voltage-gated potassium channel subunit Kv4.1.

Gene ID

3750

Accession Number

NP_004970

Reactivity

Homo sapiens|Human

Target

Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I (To) current in heart and I (Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.

Type

Protein

Source

Yeast

Sequence

NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KCND1

Protein Name

Potassium voltage-gated channel subfamily D member 1

Gene Name URL

KCND1

Nucleotide Accession Number

NM_004979

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myf5 Polyclonal Antibody
CAC11721-01 50 µg

Myf5 Polyclonal Antibody

Sign In for Pricing
View Details
Myf5 Polyclonal Antibody
CAC11721-02 100 µg

Myf5 Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Transglutaminase 2, Tissue (TGM2) ELISA Kit
abx364417 96 Well

Sheep Transglutaminase 2, Tissue (TGM2) ELISA Kit

Sign In for Pricing
View Details
CDKN2AIPNL Double Nickase Plasmid (m)
sc-424637-NIC 20 µg

CDKN2AIPNL Double Nickase Plasmid (m)

Sign In for Pricing
View Details
KAT6B Protein Vector (Human) (pPB-C-His)
PV088362 500 ng

KAT6B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
KCTD1 Lentiviral Activation Particles (h2)
sc-406758-LAC-2 200 µL

KCTD1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details