What is the catalog number for KCND1 Recombinant Protein (Human)?

The catalog number for KCND1 Recombinant Protein (Human) is OPCA04100-100UG.

What sizes are available for KCND1 Recombinant Protein (Human)?

KCND1 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is KCND1 Recombinant Protein (Human) in stock?

KCND1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

KCND1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Potassium voltage-gated channel subfamily D member 1

Gene Aliases

KV4.1; potassium channel, voltage gated Shal related subfamily D, member 1; potassium voltage-gated channel subfamily D member 1; potassium voltage-gated channel, Shal-related subfamily, member 1; Shal-type potassium channel; voltage-gated potassium channel subunit Kv4.1.

Gene ID

3750

Accession Number

NP_004970

Reactivity

Homo sapiens|Human

Target

Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I (To) current in heart and I (Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.

Type

Protein

Source

Yeast

Sequence

NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.