What is the catalog number for IL2RB Recombinant Protein (Mouse)?

The catalog number for IL2RB Recombinant Protein (Mouse) is OPCA04098-20UG.

What sizes are available for IL2RB Recombinant Protein (Mouse)?

IL2RB Recombinant Protein (Mouse) is available in the following size(s): 20 µg.

Is IL2RB Recombinant Protein (Mouse) in stock?

IL2RB Recombinant Protein (Mouse) is currently made to order / not held in immediate stock. Contact us for lead time.

IL2RB Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 2 receptor, beta chain

Gene Aliases

CD122; high affinity IL-2 receptor subunit beta; IL-15 receptor beta chain; IL15R; IL-15R; IL15Rbeta; IL-15Rbeta; IL-2 receptor beta chain; IL-2 receptor subunit beta; IL-2/15 receptor-beta; Il-2/15Rbeta; Il-2R; IL-2R subunit beta; IL-2RB; Il-2Rbeta; interleukin-2 receptor subunit beta; p70; p70-75.

Gene ID

16185

Accession Number

NP_032394

Reactivity

Mouse|Mus musculus

Target

Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

Type

Protein

Source

Yeast

Sequence

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.