What is the catalog number for GZMB Recombinant Protein (Human)?

The catalog number for GZMB Recombinant Protein (Human) is OPCA04092-20UG.

What sizes are available for GZMB Recombinant Protein (Human)?

GZMB Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is GZMB Recombinant Protein (Human) in stock?

GZMB Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

GZMB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Granzyme B

Gene Aliases

C11; cathepsin G-like 1; CCPI; CGL1; CGL-1; CSPB; CSP-B; CTLA1; CTLA-1; CTSGL1; cytotoxic serine protease B; cytotoxic T-lymphocyte proteinase 2; fragmentin 2; Fragmentin-2; granzyme B; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) ; Granzyme-2; HLP; human lymphocyte protein; SECT; T-cell serine protease 1-3E.

Gene ID

3002

Accession Number

NP_004122

Reactivity

Homo sapiens|Human

Target

This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

Type

Protein

Source

Yeast

Sequence

IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.