Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GUCA2B Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Guanylate cyclase activator 2b (retina)

Gene Aliases

AV066530; Gca; Gcap2; granule cell antiserum positive 2; guanylate cyclase activator 2B; Ugn; urog; uroguanylin.

Gene ID

14916

Accession Number

NP_032217

Reactivity

Mouse|Mus musculus

Target

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport (By similarity) .

Type

Protein

Source

Yeast

Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Guca2b

Protein Name

Guanylate cyclase activator 2B

Gene Name URL

Guca2b

Nucleotide Accession Number

NM_008191

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Interleukin 15 ELISA kit
GTR10390301 96 Well

Guinea Pig Interleukin 15 ELISA kit

Sign In for Pricing
View Details
HSPB2 Antibody
E92350 100 µg

HSPB2 Antibody

Sign In for Pricing
View Details
Rat Secretory Immunoglobulin A (sIgA) ELISA Kit
RDR-sIgA-Ra-01 48T

Rat Secretory Immunoglobulin A (sIgA) ELISA Kit

Sign In for Pricing
View Details
Rat Secretory Immunoglobulin A (sIgA) ELISA Kit
RDR-sIgA-Ra-02 96T

Rat Secretory Immunoglobulin A (sIgA) ELISA Kit

Sign In for Pricing
View Details
DKKL1 Peptide
DF14553-BP 1 mg

DKKL1 Peptide

Sign In for Pricing
View Details
Tert-Butyl 4- (piperazine-1-carbonyl) piperazine-1-carboxylate
DIA52035-01 50 mg

Tert-Butyl 4- (piperazine-1-carbonyl) piperazine-1-carboxylate

Sign In for Pricing
View Details