Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fibroblast growth factor receptor 3

Gene Aliases

ACH; CD333; CEK2; FGFR-3; fibroblast growth factor receptor 3; fibroblast growth factor receptor 3 variant 4; fibroblast growth factor receptor 3-S; HSFGFR3EX; hydroxyaryl-protein kinase; JTK4; tyrosine kinase JTK4.

Gene ID

2261

Accession Number

NP_000133

Reactivity

Homo sapiens|Human

Target

Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.

Type

Protein

Source

Yeast

Sequence

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FGFR3

Protein Name

Fibroblast growth factor receptor 3

Gene Name URL

FGFR3

Nucleotide Accession Number

NM_000142

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Aff4 Pre-designed siRNA Set B
SI200372B 1 Each

Rat Aff4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Thyroglobulin Mouse Monoclonal Antibody
orb705408-01 30 µL

Thyroglobulin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin Mouse Monoclonal Antibody
orb705408-02 50 μL

Thyroglobulin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin Mouse Monoclonal Antibody
orb705408-03 100 µL

Thyroglobulin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin Mouse Monoclonal Antibody
orb705408-04 200 µL

Thyroglobulin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-APG5L/ATG5 Antibody Picoband® Fluoro647 Conjugated
PA2260-Fluoro647 100 µg/Vial

Anti-APG5L/ATG5 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details