Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Delta like non-canonical Notch ligand 1

Gene Aliases

Delta1; delta-like 1 homolog; DLK; DLK-1; FA1; fetal antigen 1; pG2; preadipocyte factor 1; Pref-1; PREF1; protein delta homolog 1; secredeltin; ZOG.

Gene ID

8788

Accession Number

NP_001304101

Reactivity

Homo sapiens|Human

Target

May have a role in neuroendocrine differentiation.

Type

Protein

Source

Yeast

Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DLK1

Protein Name

Protein delta homolog 1

Gene Name URL

DLK1

Nucleotide Accession Number

NM_001317172

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Ultrasensitivity Thyroxine ELISA Kit
MBS066783 Inquire

Duck Ultrasensitivity Thyroxine ELISA Kit

Sign In for Pricing
View Details
Gpx2 3'UTR GFP Stable Cell Line
TU255418 1.0 mL

Gpx2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Escherichia coli Putative type II secretion system protein E (gspE)
MBS1248361-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Putative type II secretion system protein E (gspE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Putative type II secretion system protein E (gspE)
MBS1248361-02 0.02 mg (Yeast)

Recombinant Escherichia coli Putative type II secretion system protein E (gspE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Putative type II secretion system protein E (gspE)
MBS1248361-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Putative type II secretion system protein E (gspE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Putative type II secretion system protein E (gspE)
MBS1248361-04 0.1 mg (Yeast)

Recombinant Escherichia coli Putative type II secretion system protein E (gspE)

Sign In for Pricing
View Details