Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHR1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Corticotropin releasing hormone receptor 1|LINC02210-CRHR1 readthrough

Gene Aliases

Corticotropin-releasing factor receptor 1; corticotropin-releasing factor type 1 receptor; Corticotropin-releasing hormone receptor 1; CRF1; CRF-R; CRFR1; CRFR-1; CRF-R1; CRF-R-1; CRHR; CRH-R1; CRH-R-1; CRHR1-IT1-CRHR1; CRHR1-IT1-CRHR1 protein; CRHR1-IT1-CRHR1 readthrough; CRHR1L; MGC57346-CRHR1; seven transmembrane helix receptor.

Gene ID

104909134|1394

Accession Number

NP_001138618

Reactivity

Homo sapiens|Human

Target

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin) . Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Type

Protein

Source

Yeast

Sequence

ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CRHR1|LINC02210-CRHR1

Protein Name

Corticotropin-releasing factor receptor 1

Gene Name URL

CRHR1|LINC02210-CRHR1

Nucleotide Accession Number

NM_001145146

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD80 Mouse mAb
E47M60904 100 µL

CD80 Mouse mAb

Sign In for Pricing
View Details
MRPL44 Antibody
orb849519 2 mg

MRPL44 Antibody

Sign In for Pricing
View Details
CD300C Antibody
13-638 100 µL

CD300C Antibody

Sign In for Pricing
View Details
MYST1 (Probable Histone Acetyltransferase MYST1, MYST Protein 1, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 1, hMOF, HMOF, MOF, PP7073, FLJ14040) (APC)
130099-APC 100 µL

MYST1 (Probable Histone Acetyltransferase MYST1, MYST Protein 1, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 1, hMOF, HMOF, MOF, PP7073, FLJ14040) (APC)

Sign In for Pricing
View Details
F8 Antibody : HRP (OABF01131-HRP)
OABF01131-HRP 100 µL

F8 Antibody : HRP (OABF01131-HRP)

Sign In for Pricing
View Details
Lentiviral human COPS2 shRNA (UAS) - Lentiviral human COPS2 shRNA (UAS) (100)
GTR15093078 1 Vial

Lentiviral human COPS2 shRNA (UAS) - Lentiviral human COPS2 shRNA (UAS) (100)

Sign In for Pricing
View Details