Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHR1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Corticotropin releasing hormone receptor 1|LINC02210-CRHR1 readthrough

Gene Aliases

Corticotropin-releasing factor receptor 1; corticotropin-releasing factor type 1 receptor; Corticotropin-releasing hormone receptor 1; CRF1; CRF-R; CRFR1; CRFR-1; CRF-R1; CRF-R-1; CRHR; CRH-R1; CRH-R-1; CRHR1-IT1-CRHR1; CRHR1-IT1-CRHR1 protein; CRHR1-IT1-CRHR1 readthrough; CRHR1L; MGC57346-CRHR1; seven transmembrane helix receptor.

Gene ID

104909134|1394

Accession Number

NP_001138618

Reactivity

Homo sapiens|Human

Target

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin) . Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Type

Protein

Source

Yeast

Sequence

ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CRHR1|LINC02210-CRHR1

Protein Name

Corticotropin-releasing factor receptor 1

Gene Name URL

CRHR1|LINC02210-CRHR1

Nucleotide Accession Number

NM_001145146

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dkk-2 shRNA (h) Lentiviral Particles
sc-37084-V 200 µL

Dkk-2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
2-Cyclohexyl-6-methoxy-N-[1- (1-methylethyl) -4-piperidinyl]-7-[3- (1-pyrrolidinyl) propoxy]-4-quinazolinamine
159529 10 mg

2-Cyclohexyl-6-methoxy-N-[1- (1-methylethyl) -4-piperidinyl]-7-[3- (1-pyrrolidinyl) propoxy]-4-quinazolinamine

Sign In for Pricing
View Details
Methoxylamine Hydrochloride
016239 50 g

Methoxylamine Hydrochloride

Sign In for Pricing
View Details
DR3 Rabbit Polyclonal Antibody (BF350)
orb1604898 100 µL

DR3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Mouse Monoclonal CD4 Antibody (11830) [PE/Cy5.5]
FAB37911PECY55 0.1 mL

Mouse Monoclonal CD4 Antibody (11830) [PE/Cy5.5]

Sign In for Pricing
View Details
CASP4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-20494R-BF488 100 µL

CASP4 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details