Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL18A1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Collagen type XVIII alpha 1 chain

Gene Aliases

Antiangiogenic agent; collagen alpha-1 (XVIII) chain; collagen, type XVIII, alpha 1; endostatin; GLCC; KNO; KNO1; KS; multi-functional protein MFP.

Gene ID

80781

Accession Number

NP_085059

Reactivity

Homo sapiens|Human

Target

Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.

Type

Protein

Source

Yeast

Sequence

QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

COL18A1

Protein Name

Collagen alpha-1 (XVIII) chain

Gene Name URL

COL18A1

Nucleotide Accession Number

NM_030582

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SMAD6 Antibody [DyLight 350]
NB100-56440UV 0.1 mL

Rabbit Polyclonal SMAD6 Antibody [DyLight 350]

Sign In for Pricing
View Details
LOXHD1 Protein Vector (Rat) (pPM-C-HA)
27541026 500 ng

LOXHD1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Endog (NM_007931) Mouse Untagged Clone
MC204029 10 µg

Endog (NM_007931) Mouse Untagged Clone

Sign In for Pricing
View Details
ZNF211 Human qPCR Template Standard (NM_006385)
HK209857 1 Kit

ZNF211 Human qPCR Template Standard (NM_006385)

Sign In for Pricing
View Details
Bovine Leukemia Inhibitory Factor (LIF) ELISpot
SPOT2357B 1 Set

Bovine Leukemia Inhibitory Factor (LIF) ELISpot

Sign In for Pricing
View Details
OR7G2, CT (OR7G2, Olfactory receptor 7G2, OST260, Olfactory receptor 19-13, Olfactory receptor OR19-6) (FITC) discontinued
039482-FITC 200 µL

OR7G2, CT (OR7G2, Olfactory receptor 7G2, OST260, Olfactory receptor 19-13, Olfactory receptor OR19-6) (FITC) discontinued

Sign In for Pricing
View Details