Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPA Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Centromere protein A

Gene Aliases

Cen; Cenp-A; centromere autoantigen A; Centromere protein A; centrosomin A; histone H3-like centromeric protein A.

Gene ID

12615

Accession Number

NP_001289058

Reactivity

Mouse|Mus musculus

Target

Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes. Replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. The presence of CENPA subtly modifies the nucleosome structure and the way DNA is wrapped around the nucleosome and gives rise to protruding DNA ends that are less well-ordered and rigid compared to nucleosomes containing histone H3. May serve as an epigenetic mark that propagates centromere identity through replication and cell division (By similarity) . Required for recruitment and assembly of kinetochore proteins, and as a consequence required for progress through mitosis, chromosome segregation and cytokinesis (PubMed:27499292) .

Type

Protein

Source

Yeast

Sequence

MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cenpa

Protein Name

Histone H3-like centromeric protein A

Gene Name URL

Cenpa

Nucleotide Accession Number

NM_001302129

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JBScreen Classic HTS II
CS-202L 96 Solutions

JBScreen Classic HTS II

Sign In for Pricing
View Details
FX CGG-6-MB-Fl 6-bp stem; 25 ug
45-0140-06 25 µg

FX CGG-6-MB-Fl 6-bp stem; 25 ug

Sign In for Pricing
View Details
Endomucin Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5884R-BF647-TR 20 µL

Endomucin Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Peptidase D (PEPD) Antibody (Biotin)
abx315915-01 20 µg

Peptidase D (PEPD) Antibody (Biotin)

Sign In for Pricing
View Details
Peptidase D (PEPD) Antibody (Biotin)
abx315915-02 50 µg

Peptidase D (PEPD) Antibody (Biotin)

Sign In for Pricing
View Details
Peptidase D (PEPD) Antibody (Biotin)
abx315915-03 100 µg

Peptidase D (PEPD) Antibody (Biotin)

Sign In for Pricing
View Details