Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL8 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-C motif chemokine ligand 8

Gene Aliases

C-C motif chemokine 8; chemokine (C-C motif) ligand 8; HC14; MCP2; MCP-2; monocyte chemoattractant protein 2; monocyte chemotactic protein 2; SCYA10; SCYA8; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2) ; small-inducible cytokine A8.

Gene ID

6355

Accession Number

NP_005614

Reactivity

Homo sapiens|Human

Target

Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2 (6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Type

Protein

Source

Yeast

Sequence

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

10.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCL8

Protein Name

C-C motif chemokine 8

Gene Name URL

CCL8

Nucleotide Accession Number

NM_005623

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RAB21 Antibody [Biotin]
NBP2-82030B 0.1 mL

Rabbit Polyclonal RAB21 Antibody [Biotin]

Sign In for Pricing
View Details
RPL34P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1970706 1.0 µg DNA

RPL34P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Lentiviral human SCYL1 sgRNA gene knockout kit - Lentiviral human SCYL1 sgRNA gene knockout kit (plasmid)
GTR15359876 1 Vial

Lentiviral human SCYL1 sgRNA gene knockout kit - Lentiviral human SCYL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque KCNG3 Protein, His (Fc)-Avi-tagged
KCNG3-2173R 50 µg

Recombinant Rhesus Macaque KCNG3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
HQNO
MBS5759231 Inquire

HQNO

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562150 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details