Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Chromobox 7

Gene Aliases

Chromobox protein homolog 7.

Gene ID

23492

Accession Number

NP_783640

Reactivity

Homo sapiens|Human

Target

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3) . Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.

Type

Protein

Source

Yeast

Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CBX7

Protein Name

Chromobox protein homolog 7

Gene Name URL

CBX7

Nucleotide Accession Number

NM_175709

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ubxn10 shRNA (UAS) - Lentiviral mouseUbxn10 shRNA (UAS, GFP) (25)
GTR15156284 1 Vial

Lentiviral mouse Ubxn10 shRNA (UAS) - Lentiviral mouseUbxn10 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Quick Step Rabbit coagulation factor II, FII ELISA Kit
QS0050Rb-01 48 Tests

Quick Step Rabbit coagulation factor II, FII ELISA Kit

Sign In for Pricing
View Details
Quick Step Rabbit coagulation factor II, FII ELISA Kit
QS0050Rb-02 96 Tests

Quick Step Rabbit coagulation factor II, FII ELISA Kit

Sign In for Pricing
View Details
Sheep Anti-Rat IgG(H+L)-BIOT
MBS679434-01 1 mg

Sheep Anti-Rat IgG(H+L)-BIOT

Sign In for Pricing
View Details
Sheep Anti-Rat IgG(H+L)-BIOT
MBS679434-02 5x 1 mg

Sheep Anti-Rat IgG(H+L)-BIOT

Sign In for Pricing
View Details