Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonyl reductase 1

Gene Aliases

15-hydroxyprostaglandin dehydrogenase;15-hydroxyprostaglandin dehydrogenase [NADP (+) ];20-beta-hydroxysteroid dehydrogenase; carbonyl reductase (NADPH) 1; carbonyl reductase [NADPH] 1; CBR; epididymis secretory sperm binding protein; hCBR1; NADPH-dependent carbonyl reductase 1; PG-9-KR; prostaglandin 9-ketoreductase; prostaglandin-E (2) 9-reductase; SDR21C1; short chain dehydrogenase/reductase family 21C member 1.

Gene ID

873

Accession Number

NP_001273718

Reactivity

Homo sapiens|Human

Target

NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.

Type

Protein

Source

Yeast

Sequence

SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CBR1

Protein Name

Carbonyl reductase [NADPH] 1

Gene Name URL

CBR1

Nucleotide Accession Number

NM_001286789

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOAP1, NT (MOAP1, PNMA4, Modulator of apoptosis 1, Paraneoplastic antigen Ma4) (Azide free) (HRP) discontinued
038523-HRP 200 µL

MOAP1, NT (MOAP1, PNMA4, Modulator of apoptosis 1, Paraneoplastic antigen Ma4) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
STNL M017-297x74-PP-CRD/1 AC Signs
820402 Card of 1 Pictogram(s)

STNL M017-297x74-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
IGHEP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1031202 1.0 µg DNA

IGHEP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
European white birch Bet v 1/Allergen Bet v I-A Nanobody
E55A13342 100 µg

European white birch Bet v 1/Allergen Bet v I-A Nanobody

Sign In for Pricing
View Details
1H-Tetrazole-5-acetic acid
sc-223202 1 g

1H-Tetrazole-5-acetic acid

Sign In for Pricing
View Details
C21orf2 (CFAP410) (NM_004928) Human Tagged Lenti ORF Clone
RC210047L3 10 µg

C21orf2 (CFAP410) (NM_004928) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details