Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF13B Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TNF superfamily member 13b

Gene Aliases

ApoL related ligand TALL-1; B lymphocyte stimulator; BAFF; B-cell-activating factor; B-lymphocyte stimulator; BLYS; CD257; delta BAFF; Delta4 BAFF; dendritic cell-derived TNF-like molecule; DTL; epididymis secretory sperm binding protein; TALL1; TALL-1; THANK; TNF and ApoL-related leukocyte expressed ligand 1; TNF- and APOL-related leukocyte expressed ligand 1; TNF homolog that activates apoptosis; TNFSF20; TNLG7A; tumor necrosis factor (ligand) superfamily, member 13b; tumor necrosis factor (ligand) superfamily, member 20; tumor necrosis factor ligand 7A; tumor necrosis factor ligand superfamily member 13B; tumor necrosis factor superfamily member 13b; tumor necrosis factor-like protein ZTNF4; ZTNF4.

Gene ID

10673

Accession Number

NP_001139117

Reactivity

Homo sapiens|Human

Target

Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.

Type

Protein

Source

E.coli

Sequence

QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TNFSF13B

Protein Name

Tumor necrosis factor ligand superfamily member 13B

Gene Name URL

TNFSF13B

Nucleotide Accession Number

NM_001145645

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt-8a (14-3)
sc-80459 100 µg/mL

Wnt-8a (14-3)

Sign In for Pricing
View Details
BCL2L1 Polyclonal Antibody, HRP Conjugated
bs-1336R-HRP 100 µL

BCL2L1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
FIBP Overexpression Lysate (Native) - (Dry Ice)
NBP2-04674 0.1 mg

FIBP Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
RAB11FIP4 (NM_032932) Human Mass Spec Standard
PH310877 10 µg

RAB11FIP4 (NM_032932) Human Mass Spec Standard

Sign In for Pricing
View Details
CCDC63 Lentiviral Activation Particles (m2)
sc-435997-LAC-2 200 µL

CCDC63 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631654 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details