Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Dickkopf WNT signaling pathway inhibitor 2

Gene Aliases

Dickkopf 2 homolog; dickkopf homolog 2; dickkopf-2; dickkopf-related protein 2; DKK-2; hDkk-2.

Gene ID

27123

Accession Number

NP_055236

Reactivity

Homo sapiens|Human

Target

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity) .

Type

Protein

Source

E.coli

Sequence

KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DKK2

Protein Name

Dickkopf-related protein 2

Gene Name URL

DKK2

Nucleotide Accession Number

NM_014421

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acrv1 (NM_021747) Rat Tagged Lenti ORF Clone
RR200590L4 10 µg

Acrv1 (NM_021747) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CNPPD1 CRISPR Activation Plasmid (h)
sc-411946-ACT 20 µg

CNPPD1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Human ZC3H3 Pre-designed siRNA Set A
SI018474A 1 Each

Human ZC3H3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pyridoxamine 5′-phosphate
orb1982113-01 1 mg

Pyridoxamine 5′-phosphate

Sign In for Pricing
View Details
Pyridoxamine 5′-phosphate
orb1982113-02 5 mg

Pyridoxamine 5′-phosphate

Sign In for Pricing
View Details
Pyridoxamine 5′-phosphate
orb1982113-03 10 mg

Pyridoxamine 5′-phosphate

Sign In for Pricing
View Details