Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AASDHPPT Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase

Gene Aliases

4'-phosphopantetheinyl transferase; AASD-PPT; ACPS; alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase; CGI-80; holo ACP synthase; holo-[acyl-carrier-protein] synthase; L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS2; LYS5; LYS5 ortholog.

Gene ID

60496

Accession Number

NP_056238

Reactivity

Homo sapiens|Human

Target

Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN.

Type

Protein

Source

E.coli

Sequence

MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AASDHPPT

Protein Name

L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase

Gene Name URL

AASDHPPT

Nucleotide Accession Number

NM_015423

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5430402E10Rik CRISPR/Cas9 KO Plasmid (m)
sc-427930 20 µg

5430402E10Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
LHX9 CRISPR Knock Out 293T Cell Line (Human)
26512141 1x 10^6 Cells / 1.0 mL

LHX9 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human Ubiquitin-like protein ATG12 ELISA Kit
MBS9428345-01 96 Tests

Human Ubiquitin-like protein ATG12 ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin-like protein ATG12 ELISA Kit
MBS9428345-02 5x 96 Tests

Human Ubiquitin-like protein ATG12 ELISA Kit

Sign In for Pricing
View Details
RAP2B siRNA (Rat)
MBS8229087-01 15 nmol

RAP2B siRNA (Rat)

Sign In for Pricing
View Details
RAP2B siRNA (Rat)
MBS8229087-02 30 nmol

RAP2B siRNA (Rat)

Sign In for Pricing
View Details