Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B10 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Hydroxysteroid 17-beta dehydrogenase 10

Gene Aliases

17-beta-hydroxysteroid dehydrogenase 10;17b-HSD10;2-methyl-3-hydroxybutyryl-CoA dehydrogenase;3-hydroxy-2-methylbutyryl-CoA dehydrogenase;3-hydroxyacyl-CoA dehydrogenase type II;3-hydroxyacyl-CoA dehydrogenase type-2; ABAD; AB-binding alcohol dehydrogenase; amyloid-beta peptide binding alcohol dehydrogenase; CAMR; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; HSD10MD; MHBD; mitochondrial ribonuclease P protein 2; mitochondrial RNase P subunit 2; MRPP2; MRX17; MRX31; MRXS10; SCHAD; SDR5C1; Short chain dehydrogenase/reductase family 5C member 1; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH.

Gene ID

3028

Accession Number

NP_001032900

Reactivity

Homo sapiens|Human

Target

Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone (PubMed:9553139, PubMed:23042678, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424) . Catalyzes the third step in the beta-oxidation of fatty acids (PubMed:9553139, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424) . Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids (PubMed:12917011) . Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids (PubMed:12917011) . By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD) (PubMed:9338779) . Essential for structural and functional integrity of mitochondria (PubMed:20077426) .

Type

Protein

Source

E.coli

Sequence

AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSD17B10

Protein Name

3-hydroxyacyl-CoA dehydrogenase type-2

Gene Name URL

HSD17B10

Nucleotide Accession Number

NM_001037811

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGAP4 siRNA (Human)
MBS8225125-01 15 nmol

AGAP4 siRNA (Human)

Sign In for Pricing
View Details
AGAP4 siRNA (Human)
MBS8225125-02 30 nmol

AGAP4 siRNA (Human)

Sign In for Pricing
View Details
AGAP4 siRNA (Human)
MBS8225125-03 5x 30 nmol

AGAP4 siRNA (Human)

Sign In for Pricing
View Details
Porcine Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
RD-FGF1-p-01 96 Tests

Porcine Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
RD-FGF1-p-02 48 Tests

Porcine Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
GSTA1 Peptide - C-terminal region
orb2000293 100 µg

GSTA1 Peptide - C-terminal region

Sign In for Pricing
View Details